Spaca3 (NM_029367) Mouse Tagged ORF Clone

SKU
MR219897
Spaca3 (Myc-DDK-tagged) - Mouse sperm acrosome associated 3 (Spaca3)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Spaca3
Synonyms 1700025M08Rik; ALLP17; Lyc3; mSLLP1; SLLP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR219897 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGCTAGGAGCCGGGCTCCCAGAAGACAGCTGTGCCCGCCTGGGATCACTTGGCTGGCCCTGGCCT
ATCTGCTCAGCTGCCTGCTTGCCTCCAGCAAGGCCAAGGTCTTCAGTCGCTGTGAGCTGGCCAAAGAGAT
GCATGACTTCGGTCTGGATGGCTACCGGGGTTATAACCTGGCTGACTGGGTCTGCCTTGCTTACTACACA
AGTGGCTTCAACACAAATGCTGTGGATCATGAAGCTGATGGAAGCACCAACAATGGCATCTTCCAGATCA
GCAGCCGGAGGTGGTGCAGAACCCTCGCCTCGAATGGCCCCAATCTTTGCAGGATATACTGCACTGATTT
GTTGAACAATGATCTCAAAGATTCTATCGTCTGTGCCATGAAGATAGTTCAAGAACCCCTGGGTCTGGGC
TATTGGGAAGCCTGGAGGCACCACTGCCAGGGCAGGGACCTCAGTGACTGGGTGGATGGCTGTGACTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR219897 protein sequence
Red=Cloning site Green=Tags(s)

MEARSRAPRRQLCPPGITWLALAYLLSCLLASSKAKVFSRCELAKEMHDFGLDGYRGYNLADWVCLAYYT
SGFNTNAVDHEADGSTNNGIFQISSRRWCRTLASNGPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLG
YWEAWRHHCQGRDLSDWVDGCDF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_029367
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_029367.1, NP_083643.1
RefSeq Size 941 bp
RefSeq ORF 492 bp
Locus ID 75622
UniProt ID Q9D9X8
Cytogenetics 11 B5
MW 18.4 kDa
Summary Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolytic activity in vitro (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Spaca3 (NM_029367) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC211671 Spaca3 (untagged) - Mouse sperm acrosome associated 3 (Spaca3), (10ug) 10 ug
$165.00
MG219897 Spaca3 (tGFP-tagged) - Mouse sperm acrosome associated 3 (Spaca3), (10ug) 10 ug
$350.00
MR219897L3 Lenti ORF clone of Spaca3 (Myc-DDK-tagged) - Mouse sperm acrosome associated 3 (Spaca3) 10 ug
$450.00
MR219897L4 Lenti ORF clone of Spaca3 (mGFP-tagged) - Mouse sperm acrosome associated 3 (Spaca3) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.