Cdk4 (NM_009870) Mouse Tagged ORF Clone

SKU
MR204246
Cdk4 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 4 (Cdk4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cdk4
Synonyms Crk3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204246 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCACTCGATATGAACCCGTGGCTGAAATTGGTGTCGGTGCCTATGGGACGGTGTACAAAGCCC
GAGATCCCCACAGTGGCCACTTTGTGGCCCTCAAGAGTGTGAGAGTTCCTAATGGAGGAGCAGCTGGAGG
GGGCCTTCCCGTCAGCACAGTTCGTGAGGTGGCCTTGTTAAGGAGGCTGGAGGCCTTTGAACATCCCAAT
GTTGTACGGCTGATGGATGTCTGTGCTACTTCCCGAACTGATCGGGACATCAAGGTCACCCTAGTGTTTG
AGCATATAGACCAGGACCTGAGGACATACCTGGACAAAGCACCTCCACCGGGCCTGCCGGTTGAGACCAT
TAAGGATCTAATGCGTCAGTTTCTAAGCGGCCTGGATTTTCTTCATGCAAACTGCATTGTTCACCGGGAC
CTGAAGCCAGAGAACATTCTAGTGACAAGTAATGGGACCGTCAAGCTGGCTGACTTTGGCCTAGCTAGAA
TCTACAGCTACCAGATGGCCCTCACGCCTGTGGTGGTTACGCTCTGGTACCGAGCTCCTGAAGTTCTTCT
GCAGTCTACATACGCAACACCCGTGGACATGTGGAGCGTTGGCTGTATCTTTGCAGAGATGTTCCGTCGG
AAGCCTCTCTTCTGTGGAAACTCTGAAGCCGACCAGTTGGGGAAAATCTTTGATCTCATTGGATTGCCTC
CAGAAGACGACTGGCCTCGAGAGGTATCTCTACCTCGAGGAGCCTTTGCCCCCAGAGGGCCTCGGCCAGT
GCAGTCAGTGGTGCCAGAGATGGAGGAGTCTGGAGCGCAGCTGCTACTGGAAATGCTGACCTTTAACCCA
CATAAGCGAATCTCTGCCTTCCGAGCCCTGCAGCACTCCTACCTGCACAAGGAGGAAAGCGACGCAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204246 protein sequence
Red=Cloning site Green=Tags(s)

MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPN
VVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRD
LKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR
KPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNP
HKRISAFRALQHSYLHKEESDAE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009870
ORF Size 909 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009870.4
RefSeq Size 1365 bp
RefSeq ORF 912 bp
Locus ID 12567
UniProt ID P30285
Cytogenetics 10 D3
MW 33.8 kDa
Summary Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cdk4 (NM_009870) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207247 Cdk4 (untagged) - Mouse cyclin-dependent kinase 4 (Cdk4), (10ug) 10 ug
$330.00
MR204246L3 Lenti ORF clone of Cdk4 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 4 (Cdk4) 10 ug
$750.00
MR204246L4 Lenti ORF clone of Cdk4 (mGFP-tagged) - Mouse cyclin-dependent kinase 4 (Cdk4) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.