Fcgr2b (NM_010187) Mouse Tagged ORF Clone

SKU
MR204036
Fcgr2b (Myc-DDK-tagged) - Mouse Fc receptor, IgG, low affinity IIb (Fcgr2b), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fcgr2b
Synonyms AI528646; CD32; F630109E10Rik; Fcgr2; Fcgr2a; FcgRII; Fcr-2; Fcr-3; fcRII; Fc[g]RII; Ly-17
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204036 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAATCCTGCCGTTCCTACTGATCCCCATGGAGAGCAACTGGACTGTTCATGTGTTCTCACGGACTT
TGTGCCATATGCTACTGTGGACAGCCGTGCTAAATCTTGCTGCTGGGACTCATGATCTTCCAAAGGCTGT
GGTCAAACTCGAGCCCCCGTGGATCCAGGTGCTCAAGGAAGACACGGTGACACTGACATGCGAAGGGACC
CACAACCCTGGGAACTCTTCTACCCAGTGGTTCCACAATGGGAGGTCCATCCGGAGCCAGGTCCAAGCCA
GCTACACGTTTAAGGCCACAGTCAATGACAGTGGAGAATATCGGTGTCAAATGGAGCAGACCCGCCTCAG
CGACCCTGTAGATCTGGGAGTGATTTCTGACTGGCTGCTGCTCCAGACCCCTCAGCTGGTGTTTCTGGAA
GGGGAAACCATCACGCTAAGGTGCCATAGCTGGAGGAACAAACCACTGAACAGGATCTCGTTCTTCCATA
ATGAAAAATCCGTGAGGTATCATCACTACAGTAGTAATTTCTCTATCCCAAAAGCCAACCACAGTCACAG
TGGGGACTACTACTGCAAAGGAAGTCTAGGAAGGACACAGCACCAGTCCAAGACTGTCACCATCACTGTC
CAAGGGCCCAAGTCCAGCAGGTCTTTACCAGTATTGACAATTGTGGCTGCTGTCACTGGGATTGCTGTCG
CAGCCATTGTTATTATCCTAGTATCCTTGGTCTATCTCAAGAAAAAACAGGTTCCAGACAATCCTCCTGA
TCTGGAAGAAGCTGCCAAAACTGAGGCTGAGAATACGATCACCTACTCACTTCTCAAGCATCCCGAAGCC
CTGGATGAAGAAACAGAGCATGATTACCAGAACCACATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR204036 protein sequence
Red=Cloning site Green=Tags(s)

MGILPFLLIPMESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKEDTVTLTCEGT
HNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLE
GETITLRCHSWRNKPLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTQHQSKTVTITV
QGPKSSRSLPVLTIVAAVTGIAVAAIVIILVSLVYLKKKQVPDNPPDLEEAAKTEAENTITYSLLKHPEA
LDEETEHDYQNHI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010187
ORF Size 879 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010187.1, NM_010187.2, NP_034317.1
RefSeq Size 1415 bp
RefSeq ORF 882 bp
Locus ID 14130
UniProt ID P08101
Cytogenetics 1 78.02 cM
MW 33 kDa
Summary Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of antigen-antibody complexes from the circulation and modulation of antibody production by B-cells. Isoform IIB1 and isoform IIB1' form caps but fail to mediate endocytosis or phagocytosis. Isoform IIB2 can mediate the endocytosis of soluble immune complexes via clathrin-coated pits. Isoform IIB1 and isoform IIB2 can down-regulate B-cell, T-cell, and mast cell activation when coaggregated to B-cell receptors for AG (BCR), T-cell receptors for AG (TCR), and Fc receptors, respectively.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fcgr2b (NM_010187) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207272 Fcgr2b (untagged) - Mouse Fc receptor, IgG, low affinity IIb (Fcgr2b), transcript variant 2, (10ug) 10 ug
$300.00
MR204036L1 Lenti ORF clone of Fcgr2b (Myc-DDK-tagged) - Mouse Fc receptor, IgG, low affinity IIb (Fcgr2b), transcript variant 2 10 ug
$750.00
MR204036L2 Lenti ORF clone of Fcgr2b (mGFP-tagged) - Mouse Fc receptor, IgG, low affinity IIb (Fcgr2b), transcript variant 2 10 ug
$750.00
MR204036L3 Lenti ORF clone of Fcgr2b (Myc-DDK-tagged) - Mouse Fc receptor, IgG, low affinity IIb (Fcgr2b), transcript variant 2 10 ug
$750.00
MR204036L4 Lenti ORF clone of Fcgr2b (mGFP-tagged) - Mouse Fc receptor, IgG, low affinity IIb (Fcgr2b), transcript variant 2 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.