Kitl (NM_013598) Mouse Tagged ORF Clone

SKU
MR203650
Kitl (Myc-DDK-tagged) - Mouse kit ligand (Kitl)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Kitl
Synonyms blz; Clo; Con; contrasted; Gb; Kitlg; Mgf; SCF; SF; Sl; SLF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203650 representing NM_013598
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAAGACACAAACTTGGATTATCACTTGCATTTATCTCCAACTGCTCCTATTTAATCCTCTCGTCA
AAACCAAGGAGATCTGCGGGAATCCTGTGACTGATAATGTAAAAGACATTACAAAACTGGTGGCAAATCT
TCCAAATGACTATATGATAACCCTCAACTATGTCGCCGGGATGGATGTTTTGCCTAGTCATTGTTGGCTA
CGAGATATGGTAATACAATTATCACTCAGCTTGACTACTCTTCTGGACAAGTTCTCAAATATTTCTGAAG
GCTTGAGTAATTACTCCATCATAGACAAACTTGGGAAAATAGTGGATGACCTCGTGTTATGCATGGAAGA
AAACGCACCGAAGAATATAAAAGAATCTCCGAAGAGGCCAGAAACTAGATCCTTTACTCCTGAAGAATTC
TTTAGTATTTTCAATAGATCCATTGATGCCTTTAAGGACTTTATGGTGGCATCTGACACTAGTGACTGTG
TGCTCTCTTCAACATTAGGTCCCGAGAAAGATTCCAGAGTCAGTGTCACAAAACCATTTATGTTACCCCC
TGTTGCAGCCAGCTCCCTTAGGAATGACAGCAGTAGCAGTAATAGGAAAGCTGCAAAGTCCCCTGAAGAC
TCGGGCCTACAATGGACAGCCATGGCATTGCCGGCTCTCATTTCGCTTGTAATTGGCTTTGCTTTTGGAG
CCTTATACTGGAAGAAGAAACAGTCAAGTCTTACAAGGGCAGTTGAAAATATACAGATTAATGAAGAGGA
TAATGAGATAAGTATGTTGCAACAGAAAGAGAGAGAATTTCAAGAGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203650 representing NM_013598
Red=Cloning site Green=Tags(s)

MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL
RDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEF
FSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPED
SGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013598
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013598.1, NM_013598.2, NM_013598.3, NP_038626.1
RefSeq Size 5449 bp
RefSeq ORF 822 bp
Locus ID 17311
UniProt ID P20826
Cytogenetics 10 51.4 cM
MW 31.1 kDa
Summary Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Kitl (NM_013598) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204279 Kitl (untagged) - Mouse kit ligand (Kitl), (10ug) 10 ug
$300.00
MG203650 Kitl (tGFP-tagged) - Mouse kit ligand (Kitl) 10 ug
$500.00
MR203650L3 Lenti ORF clone of Kitl (Myc-DDK-tagged) - Mouse kit ligand (Kitl) 10 ug
$600.00
MR203650L4 Lenti ORF clone of Kitl (mGFP-tagged) - Mouse kit ligand (Kitl) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.