Elovl6 (NM_130450) Mouse Tagged ORF Clone

SKU
MR203544
Elovl6 (Myc-DDK-tagged) - Mouse ELOVL family member 6, elongation of long chain fatty acids (yeast) (Elovl6)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Elovl6
Synonyms C77826; FAE; LCE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203544 representing NM_130450
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACATGTCAGTGTTGACTTTACAAGAATATGAATTCGAAAAGCAGTTCAACGAGAACGAAGCCATCC
AATGGATGCAGGAAAACTGGAAGAAGTCTTTCCTGTTTTCTGCGCTGTACGCTGCCTTTATCTTTGGTGG
TCGGCATCTGATGAACAAGCGAGCCAAGTTTGAACTTCGGAAGCCGCTCGTGCTCTGGTCGCTGACTCTT
GCCGTCTTCAGTATATTCGGTGCTCTTCGAACTGGTGCTTACATGCTGTACATTCTGATGACCAAAGGCC
TGAAGCAGTCAGTTTGTGACCAGAGTTTTTACAATGGACCTGTCAGCAAATTCTGGGCTTATGCATTTGT
GCTCAGCAAAGCACCCGAACTAGGTGACACGATATTCATCATTCTGAGGAAACAGAAACTGATCTTCCTG
CACTGGTACCACCACATCACTGTGCTCCTGTACTCCTGGTACTCCTACAAAGACATGGTCGCTGGGGGTG
GTTGGTTCATGACTATGAACTATGGCGTGCATGCCGTCATGTACTCTTACTACGCCTTGCGGGCTGCGGG
TTTCCGAGTCTCCCGGAAGTTTGCCATGTTCATCACCTTGTCCCAGATCACTCAGATGCTGATGGGCTGT
GTCATTAACTACCTGGTCTTCAACTGGATGCAGCATGACAACGACCAGTGCTACTCCCACTTTCAGAACA
TCTTCTGGTCCTCGCTCATGTACCTCAGCTACCTTGTGCTCTTCTGCCATTTCTTCTTTGAGGCCTACAT
CGGCAAAGTGAAGAAAGCCACGAAGGCTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203544 representing NM_130450
Red=Cloning site Green=Tags(s)

MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTL
AVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFL
HWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGC
VINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATKAE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_130450
ORF Size 801 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_130450.2, NP_569717.1
RefSeq Size 5951 bp
RefSeq ORF 804 bp
Locus ID 170439
UniProt ID Q920L5
Cytogenetics 3 G3
MW 32.1 kDa
Summary Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Elovl6 (NM_130450) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC212315 Elovl6 (untagged) - Mouse ELOVL family member 6, elongation of long chain fatty acids (yeast) (Elovl6), (10ug) 10 ug
$330.00
MG203544 Elovl6 (tGFP-tagged) - Mouse ELOVL family member 6, elongation of long chain fatty acids (yeast) (Elovl6) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR203544L3 Lenti ORF clone of Elovl6 (Myc-DDK-tagged) - Mouse ELOVL family member 6, elongation of long chain fatty acids (yeast) (Elovl6) 10 ug
$600.00
MR203544L4 Lenti ORF clone of Elovl6 (mGFP-tagged) - Mouse ELOVL family member 6, elongation of long chain fatty acids (yeast) (Elovl6) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.