Eif4e2 (BC049077) Mouse Tagged ORF Clone

SKU
MR203331
Eif4e2 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Eif4e2
Synonyms 2700069E09Rik; AI036339; AV129531; D0H0S6743E; Eif4el3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203331 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAACAAGTTCGACGCCTTAAAAGATGATGACAGTGGAGACCATGATCAGAATGAAGAAAACAGCA
CACAGAAAGATGGTGAGAAGGAAAAAACAGACCGAGACAAGAGCCAGAGCAGTGGCAAGAGGAAGGCTGT
TGTCCCTGGACCAGCAGAGCATCCCCTGCAGTACAACTACACCTTTTGGTACTCGAGGAGAACCCCTGGC
CGTCCCACCAGCTCGCAGAGCTATGAGCAGAACATCAAGCAGATTGGCACCTTTGCCTCTGTGGAGCAGT
TCTGGAAGTTTTACAGCCACATGGTACGTCCTGGGGACCTGACAGGCCACAGTGACTTTCATCTCTTCAA
AGAAGGGATTAAACCTATGTGGGAGGATGATGCAAATAAAAATGGGGGCAAGTGGATCATTCGACTCCGG
AAGGGCTTAGCTTCCCGCTGCTGGGAGAATCTCATCCTGGCTATGCTCGGGGAGCAATTCATGGTTGGGG
AGGAGATCTGCGGGGCTGTGGTCTCTGTCCGCTTTCAGGAGGACATTATTTCTATATGGAATAAGACTGC
CAGCGACCAAGCAACTACAGCCCGAATCCGGGATACTCTTCGGCGCGTGCTTAACCTACCTCCCAACACC
ATTATGGAATACAAAACTCACACCGACAGCATTGCACCTCAGGGAACCATGAGTTCCAAACTATGTCTCA
TGGTTAACCCCTTAAAGGTCACCAGACCTCATGCTTCTACGTTCCCGCTTGGCTCCGTGCACCAACAGAT
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203331 protein sequence
Red=Cloning site Green=Tags(s)

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPG
RPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR
KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT
IMEYKTHTDSIAPQGTMSSKLCLMVNPLKVTRPHASTFPLGSVHQQI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC049077
ORF Size 771 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC049077, AAH49077
RefSeq Size 2855 bp
RefSeq ORF 773 bp
Locus ID 26987
Cytogenetics 1 C5
MW 29.3 kDa
Summary Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:15153109). Acts as a repressor of translation initiation (By similarity). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (PubMed:15153109).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Eif4e2 (BC049077) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC217774 Eif4e2 (untagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556), (10ug) 10 ug
$330.00
MG203331 Eif4e2 (tGFP-tagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556) 10 ug
$650.00
MR203331L1 Lenti ORF clone of Eif4e2 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556) 10 ug
$750.00
MR203331L2 Lenti ORF clone of Eif4e2 (mGFP-tagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556) 10 ug
$750.00
MR203331L3 Lenti ORF clone of Eif4e2 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556) 10 ug
$750.00
MR203331L4 Lenti ORF clone of Eif4e2 (mGFP-tagged) - Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.