Fcgr4 (NM_144559) Mouse Tagged ORF Clone

SKU
MR203178
Fcgr4 (Myc-DDK-tagged) - Mouse Fc receptor, IgG, low affinity IV (Fcgr4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fcgr4
Synonyms 4833442P21Rik; CD16-2; FcgammaRIV; Fcgr3a; FcgRIV; Fcrl3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203178 representing NM_144559
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCAGCTACTACTACCAACAGCTCTGGTACTTACAGCTTTCTCTGGCATTCAAGCTGGTCTCCAAA
AGGCTGTGGTGAACCTAGACCCCAAGTGGGTCAGGGTGCTTGAGGAAGACAGCGTGACCCTCAGATGCCA
AGGCACTTTCTCCCCCGAGGACAATTCTATCAAGTGGTTCCATAACGAAAGCCTCATCCCACACCAGGAT
GCCAACTATGTCATCCAAAGTGCCAGAGTTAAGGACAGTGGAATGTACAGGTGCCAGACAGCCCTCTCCA
CGATCAGTGACCCAGTGCAACTAGAGGTCCATATGGGCTGGCTATTGCTTCAGACCACTAAGTGGCTGTT
CCAGGAGGGGGACCCCATTCATCTGAGATGCCACAGTTGGCAAAACAGACCTGTACGGAAGGTCACCTAT
TCACAGAACGGCAAAGGCAAGAAGTATTTCCATGAAAATTCTGAATTACTCATTCCAAAAGCTACACACA
ATGACAGTGGCTCCTACTTCTGCAGAGGGCTCATTGGACACAACAACAAATCTTCAGCATCCTTTCGTAT
AAGCCTAGGCGATCCAGGGTCTCCATCCATGTTTCCACCGTGGCATCAAATCACATTCTGCCTGCTGATA
GGACTCTTGTTTGCAATAGACACAGTGCTGTATTTCTCTGTGCGGAGGGGTCTTCAAAGTCCTGTGGCTG
ACTATGAGGAACCCAAGATTCAATGGAGCAAGGAACCTCAGGACAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203178 representing NM_144559
Red=Cloning site Green=Tags(s)

MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQD
ANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTY
SQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLI
GLLFAIDTVLYFSVRRGLQSPVADYEEPKIQWSKEPQDK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_144559
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_144559.1, NP_653142.1
RefSeq Size 1304 bp
RefSeq ORF 750 bp
Locus ID 246256
UniProt ID A0A0B4J1G0
Cytogenetics 1 78.53 cM
MW 28.8 kDa
Summary Receptor for the Fc region of immunoglobulin gamma (PubMed:16039578). Also acts as a receptor for the Fc region of immunoglobulin epsilon (PubMed:17558411, PubMed:18949059). Binds with intermediate affinity to both IgG2a and IgG2b (PubMed:16039578, PubMed:17558411, PubMed:19795417). Can bind to IgG2a and IgG2b monomers (PubMed:18949059). Does not display binding to IgG1 or IgG3 (PubMed:16039578). Mediates neutrophil activation by IgG complexes redundantly with Fcgr3 (PubMed:18097064). Plays a role in promoting bone resorption by enhancing osteoclast differentiation following binding to IgG2a (PubMed:25824719). Binds with low affinity to both the a and b allotypes of IgE (PubMed:18949059). Has also been shown to bind to IgE allotype a only but not to allotype b (PubMed:17558411). Binds aggregated IgE but not the monomeric form and bound monomeric IgG is readily displaced by IgE complexes (PubMed:18949059). Binding to IgE promotes macrophage-mediated phagocytosis, antigen presentation to T cells, production of proinflammatory cytokines and the late phase of cutaneous allergic reactions (PubMed:17558411, PubMed:18949059).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fcgr4 (NM_144559) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC205356 Fcgr4 (untagged) - Mouse Fc receptor, IgG, low affinity IV (Fcgr4), (10ug) 10 ug
$300.00
MG203178 Fcgr4 (tGFP-tagged) - Mouse Fc fragment of IgG, low affinity IIIa, receptor (Fcgr3a) 10 ug
$500.00
MR203178L3 Lenti ORF clone of Fcgr4 (Myc-DDK-tagged) - Mouse Fc receptor, IgG, low affinity IV (Fcgr4) 10 ug
$600.00
MR203178L4 Lenti ORF clone of Fcgr4 (mGFP-tagged) - Mouse Fc receptor, IgG, low affinity IV (Fcgr4) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.