Spc25 (BC027121) Mouse Tagged ORF Clone

SKU
MR202652
Spc25 (Myc-DDK-tagged) - Mouse SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae) (cDNA clone MGC:38808 IMAGE:5359960)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Spc25
Synonyms 2600017H08Rik; 2610205L13Rik; Spbc25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202652 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGAAGACGAATTGGCACTCTTAAATCAAAGCATCAATGAATTTGGGGATAAGTTCAGAAACAGAC
TCGATGATAATCATAGTCAAGTGCTGGGACTTAGAGACGCCTTCAAGGACTCCATGAAAGCGTTTTCAGA
AAAGATGTCTTTGAAATTAAAGGAAGAAGAGAGGATGACTGAGATGATTCTGGAGTATAAAAACCAGCTC
TGTAAGCAGAATAAGCTCATTCAAGAAAAGAAAGAGAATGTGTTGAAGATGATTGCTGAAGTAAAAGGCA
AGGAGCAAGAGTCGGAAGAGCTGACTGCTAAAATCCAGGAGCTCAAGGAAGAGTACGCTAGGAAGAGGGA
AACCATTTCCACTGCTAACAAAGCTAATGAAGAGAGATTGAAAGGACTGCAGAAATCAGCGGATCTGTAT
AGAGATTACCTTGGACTAGAAATTAGAAAGATTCACGGTAATAAATTGCAGTTTATATTTACTAGTATTG
ACCCTAAGAATCCTGAGAGCCCATATATGTTTTCCATGAGCATAAATGAAGCTAAGGAATATGAAGTGTA
CGACAGTTCGCCTCATCTTGAGTGCCTAGCAGAATTTCAGGAGAAAGTCAGGAAGACCAACAATTTTTCA
GCTTTTCTTGCCAATATTCGGAAGGCTTTTATAGCTAAGGTTCATAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202652 protein sequence
Red=Cloning site Green=Tags(s)

MGEDELALLNQSINEFGDKFRNRLDDNHSQVLGLRDAFKDSMKAFSEKMSLKLKEEERMTEMILEYKNQL
CKQNKLIQEKKENVLKMIAEVKGKEQESEELTAKIQELKEEYARKRETISTANKANEERLKGLQKSADLY
RDYLGLEIRKIHGNKLQFIFTSIDPKNPESPYMFSMSINEAKEYEVYDSSPHLECLAEFQEKVRKTNNFS
AFLANIRKAFIAKVHN

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC027121
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC027121, AAH27121
RefSeq Size 1344 bp
RefSeq ORF 680 bp
Locus ID 66442
Cytogenetics 2 C2
MW 26.5 kDa
Summary This gene encodes a component of the kinetochore-associated NDC80 protein complex, which is required for the mitotic spindle checkpoint and for microtubule-kinetochore attachment. During meiosis in mouse, the protein localizes to the germinal vesicle and then is associated with the chromosomes following germinal vesicle breakdown. Knockdown of this gene in oocytes results in precocious polar body extrusion, chromosome misalignment and aberrant spindle formation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
Write Your Own Review
You're reviewing:Spc25 (BC027121) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC217821 Spc25 (untagged) - Mouse SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae) (cDNA clone MGC:38808 IMAGE:5359960),, (10ug) 10 ug
$330.00
MG202652 Spc25 (tGFP-tagged) - Mouse SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae) (cDNA clone MGC:38808 IMAGE:5359960) 10 ug
$500.00
MR202652L3 Lenti ORF clone of Spc25 (Myc-DDK-tagged) - Mouse SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae) (cDNA clone MGC:38808 IMAGE:5359960) 10 ug
$600.00
MR202652L4 Lenti ORF clone of Spc25 (mGFP-tagged) - Mouse SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae) (cDNA clone MGC:38808 IMAGE:5359960) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.