Trp53inp2 (NM_178111) Mouse Tagged ORF Clone

SKU
MR202527
Trp53inp2 (Myc-DDK-tagged) - Mouse transformation related protein 53 inducible nuclear protein 2 (Trp53inp2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Trp53inp2
Synonyms 1110029F20Rik; Tp53inp2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202527 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCAGCGCTTCACCAGCCTTTTCTTCAACACCCCTGCGCCTCCTGAAGACTCCAACTGTCCGGGGG
CCTTTGTCTCTGAGGAGGATGAAGTGGATGGCTGGCTCATCATCGACCTACAGGACAGCTATACAGCTCC
TCCCGACCCCGGGGCCTCGCCTGCTCCTGCAGGCCGCCCTCCACCCGCGCCCTCCTTGATGGATGAGAGC
TGGTTTGTTACCCCTCCCGCCTGTTTTACTGCAGAGGGGCCCGGCCTTGGGCCTGCCCGCCTCCAGAGCA
ATCCGCTGGAGGACCTCCTCATTGAGCATCCCAGCATGTCCGTTTATGTCACCGGCAGCACCATAGTGCT
GGAGTCTGGGCCACCTTCCCCTCACCCTGAAGCTGCCTTGCCTGATCAGGACCTCAGCGATGGAGAGCTG
GCGCCTGCCCTCCGGGAACCCAGGGCCTTGCACCACGCAGCTGCTCCTATGCCCGCTCGAGCTGTGCTGC
TGGAGAAGGCTGGCCAGGTGCGGAGGCTGCAGAGAGCCCGACAGCGGGCTGAGCGCCACACATTGAGTGC
TAAAGTGTTGCAACGGCAGAATCGCGCCCGGGAGAGCCGTTCGCGCCGGCCCAAGCACCAGGGCAGCTTT
ATTTACCAGCCGTGCCAGCGCCAGTTCAACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202527 protein sequence
Red=Cloning site Green=Tags(s)

MFQRFTSLFFNTPAPPEDSNCPGAFVSEEDEVDGWLIIDLQDSYTAPPDPGASPAPAGRPPPAPSLMDES
WFVTPPACFTAEGPGLGPARLQSNPLEDLLIEHPSMSVYVTGSTIVLESGPPSPHPEAALPDQDLSDGEL
APALREPRALHHAAAPMPARAVLLEKAGQVRRLQRARQRAERHTLSAKVLQRQNRARESRSRRPKHQGSF
IYQPCQRQFNY

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178111
ORF Size 663 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178111.3, NP_835212.1
RefSeq Size 3934 bp
RefSeq ORF 666 bp
Locus ID 68728
UniProt ID Q8CFU8
Cytogenetics 2 H1
MW 24.3 kDa
Summary Dual regulator of transcription and autophagy. Positively regulates autophagy and is required for autophagosome formation and processing. May act as a scaffold protein that recruits MAP1LC3A, GABARAP and GABARAPL2 and brings them to the autophagosome membrane by interacting with VMP1 where, in cooperation with the BECN1-PI3-kinase class III complex, they trigger autophagosome development. Acts as a transcriptional activator of THRA.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Trp53inp2 (NM_178111) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207669 Trp53inp2 (untagged) - Mouse transformation related protein 53 inducible nuclear protein 2 (Trp53inp2), (10ug) 10 ug
$330.00
MG202527 Trp53inp2 (tGFP-tagged) - Mouse transformation related protein 53 inducible nuclear protein 2 (Trp53inp2) 10 ug
$500.00
MR202527L3 Lenti ORF clone of Trp53inp2 (Myc-DDK-tagged) - Mouse transformation related protein 53 inducible nuclear protein 2 (Trp53inp2) 10 ug
$600.00
MR202527L4 Lenti ORF clone of Trp53inp2 (mGFP-tagged) - Mouse transformation related protein 53 inducible nuclear protein 2 (Trp53inp2) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.