U2af1l4 (NM_170760) Mouse Tagged ORF Clone

SKU
MR202513
U2af1l4 (Myc-DDK-tagged) - Mouse U2 small nuclear RNA auxiliary factor 1-like 4 (U2af1l4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol U2af1l4
Synonyms AA407033; AF419339; AI451269; AW553050; U2af26
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202513 representing NM_170760
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAATATTTAGCTTCGATATTCGGGACTGAGAAGGACAAGGTTAACTGCTCTTTTTACTTTAAGA
TTGGAGCCTGCCGGCACGGGGACCGGTGCTCCCGACTTCACAACAAACCGACTTTCAGCCAGACCATAGT
CCTGCTCAACTTGTACCGGAATCCACAGAACACAGCCCAAACTGCAGATGGATCACACTGTCACGTGAGC
GACGTGGAGGTGCAAGAACACTATGATAACTTCTTTGAGGAGGTATTCACAGAACTGCAGGAGAAGTATG
GAGAGATTGAAGAGATGAATGTGTGTGACAACCTCGGGGACCACCTCGTGGGCAATGTCTACGTTAAGTT
CCGGCGGGAGGAGGATGCAGAGCGGGCTGTAGCGGAACTCAATAACCGCTGGTTCAACGGGCAGGCTGTG
CATGCCGAGCTGTCTCCTGTCACTGACTTCCGAGAGTCCTGCTGCCGGCAGTATGAGATGGGGGAATGCA
CCCGAGGTGGCTTCTGCAACTTTATGCACCTACGGCCCATATCTCGGAACTTGCGCCGGCAGCTCTATGG
GCGAGGACCCAGGCATAGGTCACCTCCAAGGTCCCACACAGGTCACCGTCCCCGAGAAAGGAACCGACGT
CGTTCCCCAGACCACCGGCATGGTCGCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202513 representing NM_170760
Red=Cloning site Green=Tags(s)

MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVS
DVEVQEHYDNFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAERAVAELNNRWFNGQAV
HAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISRNLRRQLYGRGPRHRSPPRSHTGHRPRERNRR
RSPDHRHGRF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_170760
ORF Size 660 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_170760.3, NP_739566.1
RefSeq Size 864 bp
RefSeq ORF 663 bp
Locus ID 233073
UniProt ID Q8BGJ9
Cytogenetics 7 B1
MW 25.8 kDa
Summary RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. It can functionally substitute for U2AF1 in constitutive splicing and enhancer-dependent splicing. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participates in the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site. Shows a preference for AGC or AGA (PubMed:11739736, PubMed:16819553, PubMed:18460468). Alternative splicing of U2AF1L4 may play a role in connecting the circadian rhythm to changing external cues: may provide a circadian buffering system in central and periphery clocks that allows synchronized adaption to clock-resetting stimuli in order to prevent potentially pathogenic desynchronization (PubMed:24837677).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:U2af1l4 (NM_170760) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204955 U2af1l4 (untagged) - Mouse U2 small nuclear RNA auxiliary factor 1-like 4 (U2af1l4), (10ug) 10 ug
$300.00
MG202513 U2af1l4 (tGFP-tagged) - Mouse U2 small nuclear RNA auxiliary factor 1-like 4 (U2af1l4) 10 ug
$500.00
MR202513L3 Lenti ORF clone of U2af1l4 (Myc-DDK-tagged) - Mouse U2 small nuclear RNA auxiliary factor 1-like 4 (U2af1l4) 10 ug
$600.00
MR202513L4 Lenti ORF clone of U2af1l4 (mGFP-tagged) - Mouse U2 small nuclear RNA auxiliary factor 1-like 4 (U2af1l4) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.