Cldn9 (NM_020293) Mouse Tagged ORF Clone

SKU
MR202414
Cldn9 (Myc-DDK-tagged) - Mouse claudin 9 (Cldn9)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cldn9
Synonyms nmf32; nmf329
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202414 representing NM_020293
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCACTGGCCTTGAACTCCTCGGCATGACCCTGGCTGTGCTAGGCTGGCTAGGAACTTTGGTGT
CCTGTGCCCTGCCACTGTGGAAGGTGACCGCCTTCATCGGCAACAGCATCGTTGTGGCCCAAGTGGTATG
GGAGGGGCTGTGGATGTCCTGTGTGGTCCAGAGCACTGGCCAGATGCAGTGCAAAGTATACGACTCACTG
CTGGCGCTGCCCCAGGACCTGCAGGCAGCCAGAGCCCTCTGTGTCGTGGCCCTCCTGCTGGCTTTGCTGG
GCCTGCTGGTGGCTATCACGGGCGCCCAGTGCACCACGTGTGTGGAGGACGAAGGTGCCAAGGCCCGTAT
CGTACTCACCGCAGGGGTCCTCCTCCTCCTCTCGGGCATTTTGGTGCTCATCCCTGTCTGCTGGACAGCC
CATGCCATCATCCAGGATTTTTATAACCCACTGGTTGCGGAAGCCCTCAAGAGAGAACTGGGGGCTTCCC
TCTACCTGGGCTGGGCTGCCGCTGCCCTGCTCATGCTAGGGGGAGGGCTCCTCTGCTGTACGTGTCCCCC
GTCACACTTTGAGCGTCCCCGCGGCCCCAGGCTGGGCTACTCCATCCCTTCCCGTTCAGGTGCTTCGGGA
CTGGATAAGAGGGACTATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202414 representing NM_020293
Red=Cloning site Green=Tags(s)

MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL
LALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTA
HAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASG
LDKRDYV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020293
ORF Size 651 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020293.3, NP_064689.2
RefSeq Size 1443 bp
RefSeq ORF 654 bp
Locus ID 56863
UniProt ID Q9Z0S7
Cytogenetics 17 A3.3
MW 23.3 kDa
Summary This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is developmentally regulated; it is expressed in neonate kidney, but disappers by adulthood. It is required for the preservation of sensory cells in the hearing organ and the gene deficiency is associated with deafness. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:Cldn9 (NM_020293) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC205905 Cldn9 (untagged) - Mouse claudin 9 (Cldn9), (10ug) 10 ug
$450.00
MG202414 Cldn9 (tGFP-tagged) - Mouse claudin 9 (Cldn9) 10 ug
$650.00
MR202414L3 Lenti ORF clone of Cldn9 (Myc-DDK-tagged) - Mouse claudin 9 (Cldn9) 10 ug
$750.00
MR202414L4 Lenti ORF clone of Cldn9 (mGFP-tagged) - Mouse claudin 9 (Cldn9) 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.