Nabp2 (NM_027257) Mouse Tagged ORF Clone

SKU
MR202322
Nabp2 (Myc-DDK-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 2B (Obfc2b)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nabp2
Synonyms 2610036N15Rik; Obfc2b; SSB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202322 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGACCGAGACCTTCGTGAAGGATATCAAGCCCGGGCTCAAGAATCTGAATCTTATCTTCATTGTAC
TGGAGACAGGCCGGGTGACCAAGACAAAGGACGGACACGAGGTTCGGACCTGTAAAGTGGCAGACAAAAC
GGGCAGCATCAACATCTCAGTATGGGACGATGTGGGCAACCTGATCCAACCTGGGGACATTATCCGACTC
ACCAAAGGGTATGCTTCAGTGTTCAAAGGTTGTCTGACACTGTACACTGGCCGTGGGGGCGATCTGCAGA
AGATTGGAGAATTCTGTATGGTTTATTCCGAAGTCCCTAATTTCAGTGAGCCCAATCCAGAGTATAACAC
GCAGCAGGCGCCCAACAAATCGGTGCAGAACAATGACAACAGCCCTACTGCCCCACAAGCGACCACGGGA
CCCCCTGCTGCCTCTCCAGCTTCCGAGAACCAGAACGGAAATGGACTGAGCACCCAGCTAGGTCCTGTGG
GTGGCCCCCATCCTTCTCACACCCCCTCACATCCCCCCAGCACCCGAATCACTCGAAGTCAACCCAACCA
CACGCCTTCCGGCCCTCCTGGCCCCTCCAGCAACCCTGTCAGCAACGGCAAAGAAACCCGAAGAAGCAGC
AAGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202322 protein sequence
Red=Cloning site Green=Tags(s)

MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRL
TKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYNTQQAPNKSVQNNDNSPTAPQATTG
PPAASPASENQNGNGLSTQLGPVGGPHPSHTPSHPPSTRITRSQPNHTPSGPPGPSSNPVSNGKETRRSS
KR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_027257
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027257.2
RefSeq Size 1106 bp
RefSeq ORF 639 bp
Locus ID 69917
UniProt ID Q8R2Y9
Cytogenetics 10 D3
MW 22.6 kDa
Summary Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nabp2 (NM_027257) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204052 Nabp2 (untagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 2B (Obfc2b), (10ug) 10 ug
$300.00
MG202322 Nabp2 (tGFP-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 2B (Obfc2b) 10 ug
$500.00
MR202322L3 Lenti ORF clone of Nabp2 (Myc-DDK-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 2B (Obfc2b) 10 ug
$600.00
MR202322L4 Lenti ORF clone of Nabp2 (mGFP-tagged) - Mouse oligonucleotide/oligosaccharide-binding fold containing 2B (Obfc2b) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.