Arl6ip1 (NM_019419) Mouse Tagged ORF Clone

SKU
MR202096
Arl6ip1 (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Arl6ip1
Synonyms Aip-1; AIP-6; AL022945; Arl6ip; ARMER; AU042858; C85138; mKIAA0069
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202096 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGGGGGATAACCGCAGCAGCAACCTGCTGGCCGTGGAGACTGCAAGTCTTGAAGAGCAGCTGC
AAGGCTGGGGAGAGGTGATGCTGATGGCTGACAAAGTCCTTCGATGGGAAAGAGCCTGGTTTCCACCTGC
CATCATGGGTGTGGTTTCCCTGCTGTTCCTGATTATCTATTATCTCGATCCATCTGTGCTGTCTGGTGTT
TCCTGCTTTGTTATGTTTTTGTGCCTGGCTGACTACCTTGTTCCCATTCTAGCACCAAGAATTTTTGGCT
CTAATAAATGGACCACTGAACAACAGCAAAGATTTCATGAAATCTGCAGTAATCTAGTAAAAACTCGACG
CAGAGCTGTGGGCTGGTGGAAACGCCTCTTTTCCCTAAAGGAAGAAAAGCCTAAAATGTACTTCATGACC
ATGATCATTTCTCTTGCTGCGGTGGCTTGGGTGGGACAGCAAGTTCACAACCTGCTTCTCACCTACCTGA
TTGTGACATTTGTGCTGTTGCTTCCTGGACTAAACCAACATGGGATCATTCTGAAGTACATTGGAATGGC
CAAAAGGGAGATAAACAAACTTCTCAAGCAAAAAGAAAAGAAAAATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202096 protein sequence
Red=Cloning site Green=Tags(s)

MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGV
SCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFSLKEEKPKMYFMT
MIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_019419
ORF Size 609 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019419.2
RefSeq Size 2154 bp
RefSeq ORF 612 bp
Locus ID 54208
UniProt ID Q9JKW0
Cytogenetics 7 F1
MW 23.4 kDa
Summary Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport (PubMed:18684713). Plays a role in the formation and stabilization of endoplasmic reticulum tubules. Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9). Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself. May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Arl6ip1 (NM_019419) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202510 Arl6ip1 (untagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1), (10ug) 10 ug
$300.00
MG202096 Arl6ip1 (tGFP-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1) 10 ug
$500.00
MR202096L1 Lenti ORF clone of Arl6ip1 (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1) 10 ug
$600.00
MR202096L2 Lenti ORF clone of Arl6ip1 (mGFP-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1) 10 ug
$600.00
MR202096L3 Lenti ORF clone of Arl6ip1 (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1) 10 ug
$600.00
MR202096L4 Lenti ORF clone of Arl6ip1 (mGFP-tagged) - Mouse ADP-ribosylation factor-like 6 interacting protein 1 (Arl6ip1) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.