Cdkn2a (NM_009877) Mouse Tagged ORF Clone

SKU
MR201412
Cdkn2a (Myc-DDK-tagged) - Mouse cyclin-dependent kinase inhibitor 2A (Cdkn2a), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cdkn2a
Synonyms Arf; ARF-INK4a; INK4a-ARF; Ink4a/Arf; MTS1; p16; p16(INK4a); p16INK4a; p19<ARF>; p19ARF; Pctr1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201412 representing NM_009877
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCGCAGGTTCTTGGTCACTGTGAGGATTCAGCGCGCGGGCCGCCCACTCCAAGAGAGGGTTTTCT
TGGTGAAGTTCGTGCGATCCCGGAGACCCAGGACAGCGAGCTGCGCTCTGGCTTTCGTGAACATGTTGTT
GAGGCTAGAGAGGATCTTGAGAAGAGGGCCGCACCGGAATCCTGGACCAGGTGATGATGATGGGCAACGT
TCACGTAGCAGCTCTTCTGCTCAACTACGGTGCAGATTCGAACTGCGAGGACCCCACTACCTTCTCCCGC
CCGGTGCACGACGCAGCGCGGGAAGGCTTCCTGGACACGCTGGTGGTGCTGCACGGGTCAGGGGCTCGGC
TGGATGTGCGCGATGCCTGGGGTCGCCTGCCGCTCGACTTGGCCCAAGAGCGGGGACATCAAGACATCGT
GCGATATTTGCGTTCCGCTGGGTGCTCTTTGTGTTCCGCTGGGTGGTCTTTGTGTACCGCTGGGAACGTC
GCCCAGACCGACGGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201412 representing NM_009877
Red=Cloning site Green=Tags(s)

MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQR
SRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHR
AIFAFRWVLFVFRWVVFVYRWERRPDRRA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009877
ORF Size 507 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009877.2, NP_034007.1
RefSeq Size 929 bp
RefSeq ORF 510 bp
Locus ID 12578
UniProt ID Q64364
Cytogenetics 4 42.15 cM
MW 19.7 kDa
Summary Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cdkn2a (NM_009877) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204612 Cdkn2a (untagged) - Mouse cyclin-dependent kinase inhibitor 2A (Cdkn2a), transcript variant 1, (10ug) 10 ug
$300.00
MR201412L1 Lenti ORF clone of Cdkn2a (Myc-DDK-tagged) - Mouse cyclin-dependent kinase inhibitor 2A (Cdkn2a), transcript variant 1 10 ug
$750.00
MR201412L2 Lenti ORF clone of Cdkn2a (mGFP-tagged) - Mouse cyclin-dependent kinase inhibitor 2A (Cdkn2a), transcript variant 1 10 ug
$750.00
MR201412L3 Lenti ORF clone of Cdkn2a (Myc-DDK-tagged) - Mouse cyclin-dependent kinase inhibitor 2A (Cdkn2a), transcript variant 1 10 ug
$750.00
MR201412L4 Lenti ORF clone of Cdkn2a (mGFP-tagged) - Mouse cyclin-dependent kinase inhibitor 2A (Cdkn2a), transcript variant 1 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.