Atg12 (NM_026217) Mouse Tagged ORF Clone

SKU
MR200886
Atg12 (Myc-DDK-tagged) - Mouse autophagy-related 12 (yeast) (Atg12)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Atg12
Synonyms 4931423H11Rik; A330058M13Rik; Apg12l; Atg12l
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200886 representing NM_026217
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAAGATTCAGAGGTTGTGCTGCAGCTCCCCTCGGCTCCTGTAGGAGCCGGCGGCGAGAGCCTTC
CAGAGCTCTCCCCGGAAACAGCCACCCCAGAGCCCCCGTCCTCGGCTGCAGTTTCGCCCGGAACGGAGGA
ACCTCCCGGAGACACCAAGAAAAAAATTGACATCCTGCTGAAGGCTGTAGGAGACACTCCTATAATGAAA
ACAAAGAAATGGGCTGTGGAGCGAACCCGGACCATCCAAGGACTCATTGACTTCATCAAAAAGTTCCTTA
AACTGGTGGCCTCGGAACAGTTGTTTATTTATGTGAATCAGTCCTTTGCCCCTTCCCCAGACCAAGAAGT
TGGAACTCTATATGAGTGTTTTGGCAGTGATGGTAAACTGGTCCTGCATTACTGCAAATCCCAGGCATGG
GGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200886 representing NM_026217
Red=Cloning site Green=Tags(s)

MSEDSEVVLQLPSAPVGAGGESLPELSPETATPEPPSSAAVSPGTEEPPGDTKKKIDILLKAVGDTPIMK
TKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW
G

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026217
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026217.3
RefSeq Size 2459 bp
RefSeq ORF 426 bp
Locus ID 67526
UniProt ID Q9CQY1
Cytogenetics 18 C
MW 15.7 kDa
Summary Ubiquitin-like protein involved in autophagy vesicles formation. Conjugation with ATG5 through a ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Atg12 (NM_026217) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC203435 Atg12 (untagged) - Mouse autophagy-related 12 (yeast) (Atg12), (10ug) 10 ug
$150.00
MG200886 Atg12 (tGFP-tagged) - Mouse autophagy-related 12 (yeast) (Atg12) 10 ug
$350.00
MR200886L3 Lenti ORF clone of Atg12 (Myc-DDK-tagged) - Mouse autophagy-related 12 (yeast) (Atg12) 10 ug
$450.00
MR200886L4 Lenti ORF clone of Atg12 (mGFP-tagged) - Mouse autophagy-related 12 (yeast) (Atg12) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.