Slpi (NM_011414) Mouse Tagged ORF Clone
SKU
MR200750
Slpi (Myc-DDK-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Slpi |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MR200750 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGTCCTGCGGCCTTTTACCTTTCACGGTGCTCCTTGCTCTGGGGATCCTGGCACCCTGGACTGTGG AAGGAGGCAAAAATGATGCTATCAAAATCGGAGCCTGCCCTGCTAAAAAGCCTGCCCAGTGCCTTAAGCT TGAGAAGCCACAATGCCGTACTGACTGGGAGTGCCCGGGAAAGCAGAGGTGCTGCCAAGATGCTTGCGGT TCCAAGTGCGTGAATCCTGTTCCCATTCGCAAACCAGTGTGGAGGAAGCCTGGGAGGTGCGTCAAAACTC AGGCAAGATGTATGATGCTTAACCCTCCCAATGTCTGCCAGAGGGACGGGCAGTGTGACGGCAAATACAA GTGCTGTGAGGGTATATGTGGGAAAGTCTGCCTGCCCCCGATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR200750 protein sequence
Red=Cloning site Green=Tags(s) MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACG SKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_011414 |
ORF Size | 393 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_011414.3 |
RefSeq Size | 894 bp |
RefSeq ORF | 396 bp |
Locus ID | 20568 |
UniProt ID | P97430 |
Cytogenetics | 2 H3 |
MW | 14.3 kDa |
Summary | Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed:9126337). Modulates the innate immune response after bacterial infection (PubMed:12615907). Contributes to regulate the inflammatory and immune responses to the intracellular parasite L.major (PubMed:25030421). Down-regulates responses to bacterial lipopolysaccharide (LPS) (PubMed:9039268, PubMed:12615907, PubMed:25030421). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed:11017147, PubMed:12615907). Has antimicrobial activity against mycobacteria, but not against salmonella (PubMed:18322212). Contributes to normal resistance against infection by M.tuberculosis (PubMed:18322212). Required for normal resistance to L.major (PubMed:25030421). Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (PubMed:11017147, PubMed:25030421). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (By similarity).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC201386 | Slpi (untagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi), (10ug) | 10 ug |
$150.00
|
|
MG200750 | Slpi (tGFP-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) | 10 ug |
$489.00
|
|
MR200750L3 | Lenti ORF clone of Slpi (Myc-DDK-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) | 10 ug |
$450.00
|
|
MR200750L4 | Lenti ORF clone of Slpi (mGFP-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) | 10 ug |
$450.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.