Slpi (NM_011414) Mouse Tagged ORF Clone

SKU
MR200750
Slpi (Myc-DDK-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Slpi
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200750 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTCCTGCGGCCTTTTACCTTTCACGGTGCTCCTTGCTCTGGGGATCCTGGCACCCTGGACTGTGG
AAGGAGGCAAAAATGATGCTATCAAAATCGGAGCCTGCCCTGCTAAAAAGCCTGCCCAGTGCCTTAAGCT
TGAGAAGCCACAATGCCGTACTGACTGGGAGTGCCCGGGAAAGCAGAGGTGCTGCCAAGATGCTTGCGGT
TCCAAGTGCGTGAATCCTGTTCCCATTCGCAAACCAGTGTGGAGGAAGCCTGGGAGGTGCGTCAAAACTC
AGGCAAGATGTATGATGCTTAACCCTCCCAATGTCTGCCAGAGGGACGGGCAGTGTGACGGCAAATACAA
GTGCTGTGAGGGTATATGTGGGAAAGTCTGCCTGCCCCCGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200750 protein sequence
Red=Cloning site Green=Tags(s)

MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACG
SKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_011414
ORF Size 393 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_011414.3
RefSeq Size 894 bp
RefSeq ORF 396 bp
Locus ID 20568
UniProt ID P97430
Cytogenetics 2 H3
MW 14.3 kDa
Summary Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed:9126337). Modulates the innate immune response after bacterial infection (PubMed:12615907). Contributes to regulate the inflammatory and immune responses to the intracellular parasite L.major (PubMed:25030421). Down-regulates responses to bacterial lipopolysaccharide (LPS) (PubMed:9039268, PubMed:12615907, PubMed:25030421). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed:11017147, PubMed:12615907). Has antimicrobial activity against mycobacteria, but not against salmonella (PubMed:18322212). Contributes to normal resistance against infection by M.tuberculosis (PubMed:18322212). Required for normal resistance to L.major (PubMed:25030421). Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (PubMed:11017147, PubMed:25030421). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Slpi (NM_011414) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201386 Slpi (untagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi), (10ug) 10 ug
$150.00
MG200750 Slpi (tGFP-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) 10 ug
$489.00
MR200750L3 Lenti ORF clone of Slpi (Myc-DDK-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) 10 ug
$450.00
MR200750L4 Lenti ORF clone of Slpi (mGFP-tagged) - Mouse secretory leukocyte peptidase inhibitor (Slpi) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.