6230409E13Rik (BC059864) Mouse Tagged ORF Clone

SKU
MR200717
6230409E13Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 6230409E13 gene (cDNA clone MGC:69721 IMAGE:6417471)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol 6230409E13Rik
Synonyms 6230409E13Rik; AW742931
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200717 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGACCCAAGCTTTCCACTCTTGATGCCACTGTCTTTGGACACTTGGCACAGGCGATGTGGACCTTAC
CAGGGACAAGACCGGAGCGGCTAATCAAAGGCGAGCTGATCAACCTGGCCATGTACTGCGAGAGGATCAG
GAGGAAATTCTGGCCCGAGTGGCACCACGATGATGACAACACCATTTATGAGTCTGAGGAGAGCAGCGAG
GGCAGCAAGACTCACACACCCATGCTGGATTTTAGCTTTTACTCCAGGACAGAGACCTTTGAGGACGAGG
GGGCTGAGAACAGTTTCTCCAGGACCCCAGACACGGATTTCACCGGACACTCTCTCTTTGACTCCGATGT
GGAGATGGATGACTACACAGACCACGAACAGTGCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200717 protein sequence
Red=Cloning site Green=Tags(s)

MGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSE
GSKTHTPMLDFSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVEMDDYTDHEQCK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC059864
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC059864, AAH59864
RefSeq Size 4035 bp
RefSeq ORF 389 bp
Locus ID 76132
Cytogenetics 4 A3
MW 15 kDa
Summary May play a role in axonal development.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:6230409E13Rik (BC059864) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC206959 6230409E13Rik (untagged) - Mouse RIKEN cDNA 6230409E13 gene (cDNA clone MGC:69721 IMAGE:6417471), (10ug) 10 ug
$165.00
MG200717 6230409E13Rik (tGFP-tagged) - Mouse RIKEN cDNA 6230409E13 gene (cDNA clone MGC:69721 IMAGE:6417471) 10 ug
$350.00
MR200717L3 Lenti ORF clone of 6230409E13Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 6230409E13 gene (cDNA clone MGC:69721 IMAGE:6417471) 10 ug
$450.00
MR200717L4 Lenti ORF clone of 6230409E13Rik (mGFP-tagged) - Mouse RIKEN cDNA 6230409E13 gene (cDNA clone MGC:69721 IMAGE:6417471) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.