Ms4a4b (BC028433) Mouse Tagged ORF Clone

SKU
MR200489
Ms4a4b (Myc-DDK-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 4B (cDNA clone MGC:41078 IMAGE:1248222)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ms4a4b
Synonyms AI463180; Chandra; Ly116
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200489 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAGGACAGGAACAGACCACCATGGCAGTGGTTCCTGGAGTTGCTGTGCCTTCAAAGAATTCTGTTA
TGACATCACAAATGTGGAATGAGAAGAAAGAGAAATTCTTGAAGGGGGAACCCAAAGTCCTTGGGGTTTT
ACAAGTGATGATTGCTATCATAAACCTCAGCTTAGGAATAATAATTTTGACAACTTTATTTTCTGAACTA
CCCACTTCAGTGATGTTAATGGTCCCAATTTGGGGATCAATAATGTTCATTGTCTCCGGATCCCTGTCCA
TTGCAGCAGGAGTGACACCTACAAAATGCCTGGTATGTAATTTGGTATGTTTTGCTATGGAAAAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200489 protein sequence
Red=Cloning site Green=Tags(s)

MQGQEQTTMAVVPGVAVPSKNSVMTSQMWNEKKEKFLKGEPKVLGVLQVMIAIINLSLGIIILTTLFSEL
PTSVMLMVPIWGSIMFIVSGSLSIAAGVTPTKCLVCNLVCFAMEKE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC028433
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC028433, AAH28433
RefSeq Size 747 bp
RefSeq ORF 350 bp
Locus ID 60361
Cytogenetics 19 A
MW 12.5 kDa
Write Your Own Review
You're reviewing:Ms4a4b (BC028433) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207085 Ms4a4b (untagged) - Mouse membrane-spanning 4-domains, subfamily A, member 4B (cDNA clone MGC:41078 IMAGE:1248222), (10ug) 10 ug
$165.00
MG200489 Ms4a4b (tGFP-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 4B (cDNA clone MGC:41078 IMAGE:1248222) 10 ug
$350.00
MR200489L3 Lenti ORF clone of Ms4a4b (Myc-DDK-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 4B (cDNA clone MGC:41078 IMAGE:1248222) 10 ug
$450.00
MR200489L4 Lenti ORF clone of Ms4a4b (mGFP-tagged) - Mouse membrane-spanning 4-domains, subfamily A, member 4B (cDNA clone MGC:41078 IMAGE:1248222) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.