Rabbit Polyclonal CUL4B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal CUL4B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal KEAP1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit anti-BRCA1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit Polyclonal anti-ERCC8 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Rabbit polyclonal Parkin Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin. |
Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
UBE2D3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2D3 |
Rabbit Polyclonal XIAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Anti-SOCS1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1 |
Anti-SOCS1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1 |
UBE2M Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2M |
Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)
Applications | IF, IHC, IP, WB |
Reactivities | Human (Predicted: Xenopus, Pig, Chicken, Bovine, Rhesus Monkey, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036) |
Rabbit polyclonal TTK (Ab-676) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |