ERCC8 Rabbit Polyclonal Antibody
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of excision repair cross-complementing rodent repair deficiency, complementation group 8 (ERCC8), transcript variant 3
USD 436.00
Other products for "ERCC8"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 44 kDa |
Gene Name | ERCC excision repair 8, CSA ubiquitin ligase complex subunit |
Database Link | |
Background | ERCC8 (excision repair cross-complementing rodent repair deficiency, complementation group 8 isoform 1) is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcript |
Synonyms | CKN1; CSA; UVSS2 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 86%; Pig: 79%; Rat: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Nucleotide excision repair, Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.