ERCC8 Rabbit Polyclonal Antibody

CAT#: TA329326

Rabbit Polyclonal anti-ERCC8 antibody

Product Images

WB Suggested Anti-ERCC8 Antibody Titration: 0.1-5.0ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

• 

  Host: Rabbit; Target Name: ERCC8; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: ERCC8; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: ERCC8; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: ERCC8; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: ERCC8; Sample Tissue: Human HepG2; Antibody Dilution: 1.0ug/ml; ERCC8 is supported by BioGPS gene expression data to be expressed in HepG2

• Host: Rabbit; Target Name: ERCC8; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

• Human Liver

• Human Muscle

Show all 9 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: ERCC excision repair 8, CSA ubiquitin ligase complex subunit
• Database Link:
  NP_000073
  Entrez Gene 1161 Human
  UniProt ID Q13216
• Background: ERCC8 (excision repair cross-complementing rodent repair deficiency, complementation group 8 isoform 1) is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcript
• Synonyms: CKN1; CSA; UVSS2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 86%; Pig: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Nucleotide excision repair, Ubiquitin mediated proteolysis