Fkbp4 (NM_010219) Mouse Recombinant Protein

SKU
TP527193
Purified recombinant protein of Mouse FK506 binding protein 4 (Fkbp4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR227193 representing NM_010219
Red=Cloning site Green=Tags(s)

MTAEEMKAAENGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGWLLDGTKFDSS
LDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVFEVELFEFKGE
DLTEEEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYHKDRLFDQRELCFEVGEGESLDLPCGLEEAIQR
MEKGEHSIVYLKPSYAFGSVGKERFQIPPHAELRYEVRLKSFEKAKESWEMSSAEKLEQSNIVKERGTAY
FKEGKYKQALLQYKKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS
NNEKGLFRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE
EEHKVKAEVAAGDHPTDAEMKGERNNVAENQSRVETEA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_034349
Locus ID 14228
UniProt ID P30416
Cytogenetics 6 F3
RefSeq Size 2167
RefSeq ORF 1374
Synonyms 59kDa; AL022792; AW208983; FKBP-4; FKBP-52; FKBP52; FKPB52; p59
Summary Immunophilin protein with PPIase and co-chaperone activities. Component of steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments. The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly. May have a protective role against oxidative stress in mitochondria.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fkbp4 (NM_010219) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.