Ccl5 (NM_013653) Mouse Recombinant Protein

SKU TP527153

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 5 (Ccl5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227153 representing NM_013653; Red=Cloning site Green=Tags(s); ; MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNR; QVCANPEKKWVQEYINYLEMS; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 10.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_038681
• Locus ID: 20304
• UniProt ID: P30882
• Cytogenetics: 11 50.66 cM
• RefSeq Size: 579
• RefSeq ORF: 273
• Synonyms: MuRantes; RANTES; Scya5; SISd; TCP228
• Summary: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.[UniProtKB/Swiss-Prot Function]