Mrpl47 (NM_029017) Mouse Recombinant Protein

SKU TP518598

Purified recombinant protein of Mouse mitochondrial ribosomal protein L47 (Mrpl47), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR218598 representing NM_029017; Red=Cloning site Green=Tags(s); ; MAATSLVGICRRASAFLKAACSLVNPKDAAHSGCRSSLSLLHKNTPHVTSFLQCKLLHTTLSRKGLEEFF; DDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDS; MDNVDKVVQEREDALRLLQTGQEKPRPGAWRRDIFGRIVWHKFKQWPIPWYLNKRYNRRRFFAMPYVDRF; IRLRIEKHARIEARKRSLQKKKEKILHAKFPHLSQERKSSSV; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_083293
• Locus ID: 74600
• UniProt ID: Q8K2Y7
• Cytogenetics: 3 A3
• RefSeq Size: 899
• RefSeq ORF: 756
• Synonyms: 4833424P18Rik; CGI-20; CGI-204; Gm9859; L47mt; MRP-L47; MTF/L47; NCM; NCM1
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene is immediately adjacent to the gene for BRG1/brm-associated factor 53A (also known as BAF complex 53 kDa subunit protein A in humans) in a tail-to-tail orientation. [provided by RefSeq, Jul 2008]