Mrpl47 (NM_029017) Mouse Tagged ORF Clone

SKU
MR218598
Mrpl47 (Myc-DDK-tagged) - Mouse mitochondrial ribosomal protein L47 (Mrpl47), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mrpl47
Synonyms 4833424P18Rik; CGI-20; CGI-204; Gm9859; L47mt; MRP-L47; MTF/L47; NCM; NCM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR218598 representing NM_029017
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGACCAGTCTAGTGGGTATTTGTAGAAGAGCCTCAGCGTTCCTGAAGGCAGCTTGTTCCCTAG
TAAATCCCAAGGACGCTGCTCACTCGGGTTGCAGGTCTTCTCTTAGTTTGTTACATAAGAACACACCACA
TGTCACATCTTTTCTCCAGTGTAAATTACTTCATACCACGTTGTCAAGGAAAGGACTGGAAGAATTTTTT
GATGACCCAAAGAATTGGGGGGAAGAAAAAGTCAAATCTGGAGCTTCATGGACCTGCCAGCAGCTGAGGA
ACAAAAGTAACGAAGACTTACATAAGCTTTGGTATGTCCTTCTGAAGGAAAGAAACATGCTTCTAACTCT
GGAGCAGGAGGCCAAGCGACAGAGGTTGCCAATGCCAAGTCCGGAGCGCTTAGAAAAGGTCGTTGATTCC
ATGGATAACGTAGATAAAGTTGTCCAGGAGAGGGAAGATGCTCTAAGGCTTCTTCAGACCGGTCAAGAAA
AGCCCAGACCCGGTGCTTGGAGAAGGGACATCTTTGGACGAATTGTCTGGCACAAATTCAAGCAGTGGCC
TATACCTTGGTACCTAAATAAAAGATACAACAGGAGGCGGTTCTTCGCAATGCCTTATGTGGATCGCTTT
ATCAGACTAAGAATTGAGAAACACGCCCGCATTGAAGCAAGAAAGAGAAGTTTACAGAAAAAGAAAGAAA
AAATTCTCCATGCAAAGTTCCCACATCTCTCTCAAGAACGGAAATCAAGTAGTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR218598 representing NM_029017
Red=Cloning site Green=Tags(s)

MAATSLVGICRRASAFLKAACSLVNPKDAAHSGCRSSLSLLHKNTPHVTSFLQCKLLHTTLSRKGLEEFF
DDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDS
MDNVDKVVQEREDALRLLQTGQEKPRPGAWRRDIFGRIVWHKFKQWPIPWYLNKRYNRRRFFAMPYVDRF
IRLRIEKHARIEARKRSLQKKKEKILHAKFPHLSQERKSSSV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_029017
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_029017.2, NP_083293.1
RefSeq Size 899 bp
RefSeq ORF 759 bp
Locus ID 74600
UniProt ID Q8K2Y7
Cytogenetics 3 A3
MW 29.7 kDa
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene is immediately adjacent to the gene for BRG1/brm-associated factor 53A (also known as BAF complex 53 kDa subunit protein A in humans) in a tail-to-tail orientation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Mrpl47 (NM_029017) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC211540 Mrpl47 (untagged) - Mouse mitochondrial ribosomal protein L47 (Mrpl47), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$330.00
MG218598 Mrpl47 (tGFP-tagged) - Mouse mitochondrial ribosomal protein L47 (Mrpl47) nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$500.00
MR218598L3 Lenti ORF clone of Mrpl47 (Myc-DDK-tagged) - Mouse mitochondrial ribosomal protein L47 (Mrpl47), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR218598L4 Lenti ORF clone of Mrpl47 (mGFP-tagged) - Mouse mitochondrial ribosomal protein L47 (Mrpl47), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.