Slirp (NM_026958) Mouse Recombinant Protein

SKU TP518296

Purified recombinant protein of Mouse SRA stem-loop interacting RNA binding protein (Slirp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR218296 representing NM_026958; Red=Cloning site Green=Tags(s); ; MAASAIKGLSALRSSTGRPIAFVRKIPWTAAASELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQ; EELQNALQQEHHIIDGVKIHVQAQRAKALHGAQTSDEERFLR; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 13.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_081234
• Locus ID: 380773
• UniProt ID: Q9D8T7
• Cytogenetics: 12 D2
• RefSeq Size: 427
• RefSeq ORF: 336
• Synonyms: 1810035L17Rik
• Summary: RNA-binding protein that acts as a nuclear receptor corepressor. Probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. Binds the STR7 loop of SRA RNA. Also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation (By similarity).[UniProtKB/Swiss-Prot Function]