Slirp (NM_026958) Mouse Tagged ORF Clone

SKU
MR218296
Slirp (Myc-DDK-tagged) - Mouse RIKEN cDNA 1810035L17 gene (1810035L17Rik)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Slirp
Synonyms 1810035L17Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR218296 representing NM_026958
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCCTCCGCCATAAAGGGGCTAAGCGCACTGCGTTCCAGTACTGGTCGGCCTATTGCGTTTGTCA
GAAAAATTCCTTGGACCGCGGCAGCGAGTGAGCTGAGAGAACATTTTGCACAGTTTGGCCATGTAAGAAG
GTGCACTGTACCTTTTGACAAAGAGACTGGCTTTCACAGAGGCATGGGTTGGGTTCAGTTTTCCTCTCAG
GAAGAACTTCAGAATGCACTACAACAAGAACATCATATTATTGATGGAGTAAAAATCCACGTTCAAGCTC
AAAGAGCAAAGGCTTTGCACGGAGCTCAAACATCTGATGAAGAAAGATTTCTGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR218296 representing NM_026958
Red=Cloning site Green=Tags(s)

MAASAIKGLSALRSSTGRPIAFVRKIPWTAAASELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQ
EELQNALQQEHHIIDGVKIHVQAQRAKALHGAQTSDEERFLR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026958
ORF Size 336 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026958.3, NP_081234.2
RefSeq Size 427 bp
RefSeq ORF 339 bp
Locus ID 380773
UniProt ID Q9D8T7
Cytogenetics 12 D2
MW 13.1 kDa
Summary RNA-binding protein that acts as a nuclear receptor corepressor. Probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. Binds the STR7 loop of SRA RNA. Also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Slirp (NM_026958) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC214676 Slirp (untagged) - Mouse RIKEN cDNA 1810035L17 gene (1810035L17Rik), (10ug) 10 ug
$165.00
MG218296 Slirp (tGFP-tagged) - Mouse RIKEN cDNA 1810035L17 gene (1810035L17Rik), (10ug) 10 ug
$350.00
MR218296L3 Lenti ORF clone of Slirp (Myc-DDK-tagged) - Mouse RIKEN cDNA 1810035L17 gene (1810035L17Rik) 10 ug
$450.00
MR218296L4 Lenti ORF clone of Slirp (mGFP-tagged) - Mouse RIKEN cDNA 1810035L17 gene (1810035L17Rik) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.