C8orf58 (NM_001198827) Human Recombinant Protein

SKU
TP331145
Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC231145 representing NM_001198827
Red=Cloning site Green=Tags(s)

MMGRRRAFAVDGRDGAGEGLARGCIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSG
VEMAVGDSPLAALPGLSQDSLDFESSGSSEPPAQVGRLLASQKLGEVLERSRRLPTAPTSLSGQHRSLRL
ASKPEREVPLGAGQQESMEADTDLEAGLEEEAVGGLGPGAWACLPGQGLRYLEHLCLVLEQMARLQQLYL
QLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPETPV
EPTYHLPSSQGHKDRVQGPP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.5
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001185756
Locus ID 541565
UniProt ID A0A087WX44
Cytogenetics 8p21.3
RefSeq ORF 900
Write Your Own Review
You're reviewing:C8orf58 (NM_001198827) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318522 C8orf58 MS Standard C13 and N15-labeled recombinant protein (NP_001013864) 10 ug
$3,255.00
LC423043 C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434144 C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434181 C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423043 Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58) 100 ug
$436.00
LY434144 Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 3 100 ug
$436.00
LY434181 Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 2 100 ug
$436.00
TP318522 Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.