C8orf58 (NM_001013842) Human Mass Spec Standard

SKU
PH318522
C8orf58 MS Standard C13 and N15-labeled recombinant protein (NP_001013864)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218522]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC218522 representing NM_001013842
Red=Cloning site Green=Tags(s)

MMGRRRAFAVDGRDGAGEGLARGCIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSG
VEMAVGDSPLAALPGLSQDSLDFESSGSSEPPAQVGRLLASQKLGEVLERSRRLPTAPTSLSGQHRSLRL
ASKPEREVPLGAGQQESMEADTDLEAGLEEEAVGGLGPGAWACLPGQGLRYLEHLCLVLEQMARLQQLYL
QLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPETPV
EPTYHLPSSQGHKRDISHWDKVKVLLNRICRRSHHHPEPPAPPDGSDPRIESRDLPERPQCRPHRKTFMP
SLVVKKQRAKNLSVG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001013864
RefSeq Size 2075
RefSeq ORF 1095
Locus ID 541565
UniProt ID Q8NAV2
Cytogenetics 8p21.3
Write Your Own Review
You're reviewing:C8orf58 (NM_001013842) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423043 C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434144 C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434181 C8orf58 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423043 Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58) 100 ug
$436.00
LY434144 Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 3 100 ug
$436.00
LY434181 Transient overexpression lysate of chromosome 8 open reading frame 58 (C8orf58), transcript variant 2 100 ug
$436.00
TP318522 Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), 20 µg 20 ug
$867.00
TP331145 Recombinant protein of human chromosome 8 open reading frame 58 (C8orf58), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.