MD2 (LY96) (NM_001195797) Human Recombinant Protein

SKU
TP330968
Purified recombinant protein of Homo sapiens lymphocyte antigen 96 (LY96), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC230968 representing NM_001195797
Red=Cloning site Green=Tags(s)

MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCGRDLKQLYFNLYITVNTMNLPKRKEVICRGSDD
DYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.9
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001182726
Locus ID 23643
UniProt ID Q9Y6Y9
Cytogenetics 8q21.11
RefSeq Size 552
RefSeq ORF 390
Synonyms ESOP-1; ly-96; MD-2; MD2
Summary This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010]
Protein Families Secreted Protein
Protein Pathways Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:MD2 (LY96) (NM_001195797) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304686 LY96 MS Standard C13 and N15-labeled recombinant protein (NP_056179) 10 ug
$3,255.00
LC414593 LY96 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414593 Transient overexpression lysate of lymphocyte antigen 96 (LY96) 100 ug
$436.00
TP304686 Recombinant protein of human lymphocyte antigen 96 (LY96), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.