MD2 (LY96) (NM_015364) Human Mass Spec Standard

SKU PH304686

LY96 MS Standard C13 and N15-labeled recombinant protein (NP_056179)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204686]
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC204686 protein sequence; Red=Cloning site Green=Tags(s); ; MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRD; LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG; SPEEMLFCLEFVILHQPNSN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_056179
• RefSeq Size: 642
• RefSeq ORF: 480
• Synonyms: ESOP-1; ly-96; MD-2; MD2
• Locus ID: 23643
• UniProt ID: Q9Y6Y9
• Cytogenetics: 8q21.11
• Summary: This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010]
• Protein Families: Secreted Protein
• Protein Pathways: Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway