MBNL3 (NM_001170701) Human Recombinant Protein

SKU
TP329854
Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC229854 representing NM_001170701
Red=Cloning site Green=Tags(s)

MERASKNLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT
PSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTR
GENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQ
PGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTT
VSAATTPATSVPFAAPTTGNQLKF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.4
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001164172
Locus ID 55796
UniProt ID Q9NUK0
Cytogenetics Xq26.2
RefSeq ORF 912
Synonyms CHCR; MBLX; MBLX39; MBXL
Summary This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009]
Write Your Own Review
You're reviewing:MBNL3 (NM_001170701) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316043 MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) 10 ug
$3,255.00
PH316093 MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) 10 ug
$3,255.00
LC408817 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413087 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432842 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432854 MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408817 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 100 ug
$436.00
LY413087 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 100 ug
$436.00
LY432842 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 100 ug
$436.00
LY432854 Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 100 ug
$436.00
TP316043 Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316093 Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329842 Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.