MBNL3 (NM_133486) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC216093] |
Predicted MW | 36.2 kDa |
Protein Sequence |
Protein Sequence
>RC216093 representing NM_133486
Red=Cloning site Green=Tags(s) MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALTNLQLPQPAFIPAGPILCMAP ASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQIPQLSIDELNSSMFVSQM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_597846 |
RefSeq Size | 1575 |
RefSeq ORF | 1002 |
Synonyms | CHCR; MBLX; MBLX39; MBXL |
Locus ID | 55796 |
UniProt ID | Q9NUK0 |
Cytogenetics | Xq26.2 |
Summary | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH316043 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) | 10 ug |
$3,255.00
|
|
LC408817 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413087 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432842 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432854 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408817 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 | 100 ug |
$436.00
|
|
LY413087 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 | 100 ug |
$436.00
|
|
LY432842 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 | 100 ug |
$436.00
|
|
LY432854 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 | 100 ug |
$436.00
|
|
TP316043 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP316093 | Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP329842 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP329854 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.