BEGAIN (NM_001159531) Human Recombinant Protein

SKU
TP328971
Recombinant protein of human brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228971 protein sequence
Red=Cloning site Green=Tags(s)

MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRI
NQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRV
HKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFC
DGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPA
GFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFA
KATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRP
LSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEP
CFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAA
RLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 64.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001153003
Locus ID 57596
UniProt ID Q9BUH8
Cytogenetics 14q32.2
RefSeq Size 2763
RefSeq ORF 1779
Summary May sustain the structure of the postsynaptic density (PSD).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:BEGAIN (NM_001159531) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300943 BEGAIN MS Standard C13 and N15-labeled recombinant protein (NP_065887) 10 ug
$3,255.00
LC412260 BEGAIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431998 BEGAIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412260 Transient overexpression lysate of brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), transcript variant 2 100 ug
$436.00
LY431998 Transient overexpression lysate of brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), transcript variant 1 100 ug
$436.00
TP300943 Recombinant protein of human brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.