BEGAIN (NM_020836) Human Mass Spec Standard

SKU
PH300943
BEGAIN MS Standard C13 and N15-labeled recombinant protein (NP_065887)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200943]
Predicted MW 64.8 kDa
Protein Sequence
Protein Sequence
>RC200943 protein sequence
Red=Cloning site Green=Tags(s)

MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRI
NQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRV
HKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFC
DGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPA
GFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFA
KATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRP
LSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEP
CFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAA
RLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065887
RefSeq Size 2689
RefSeq ORF 1779
Locus ID 57596
UniProt ID Q9BUH8
Cytogenetics 14q32.2
Summary May sustain the structure of the postsynaptic density (PSD).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:BEGAIN (NM_020836) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412260 BEGAIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431998 BEGAIN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412260 Transient overexpression lysate of brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), transcript variant 2 100 ug
$436.00
LY431998 Transient overexpression lysate of brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), transcript variant 1 100 ug
$436.00
TP300943 Recombinant protein of human brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP328971 Recombinant protein of human brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.