ABHD14B (NM_001146314) Human Recombinant Protein

SKU TP328763L

Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), transcript variant 2, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228763 protein sequence; Red=Cloning site Green=Tags(s); ; MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP; GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD; KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001139786
• Locus ID: 84836
• UniProt ID: Q96IU4
• Cytogenetics: 3p21.2
• RefSeq Size: 2253
• RefSeq ORF: 630
• Synonyms: CIB; HEL-S-299
• Summary: Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.[UniProtKB/Swiss-Prot Function]