ABHD14B (NM_001146314) Human Recombinant Protein

SKU
TP328763
Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228763 protein sequence
Red=Cloning site Green=Tags(s)

MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLP
GLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTD
KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001139786
Locus ID 84836
UniProt ID Q96IU4
Cytogenetics 3p21.2
RefSeq Size 2253
RefSeq ORF 630
Synonyms CIB; HEL-S-299
Summary Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ABHD14B (NM_001146314) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303520 ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) 10 ug
$3,255.00
LC409958 ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431791 ABHD14B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409958 Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 1 100 ug
$436.00
LY431791 Transient overexpression lysate of abhydrolase domain containing 14B (ABHD14B), transcript variant 2 100 ug
$436.00
TP303520 Recombinant protein of human abhydrolase domain containing 14B (ABHD14B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.