WDR79 (WRAP53) (NM_001143992) Human Recombinant Protein
SKU
TP327786
Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC227786 protein sequence
Red=Cloning site Green=Tags(s) MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 59.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001137464 |
Locus ID | 55135 |
UniProt ID | Q9BUR4 |
Cytogenetics | 17p13.1 |
RefSeq Size | 1896 |
RefSeq ORF | 1644 |
Synonyms | DKCB3; TCAB1; WDR79 |
Summary | This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. [provided by RefSeq, Mar 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300142 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_060551) | 10 ug |
$3,255.00
|
|
PH327755 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137462) | 10 ug |
$3,255.00
|
|
PH327773 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137463) | 10 ug |
$3,255.00
|
|
PH327786 | WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137464) | 10 ug |
$3,255.00
|
|
LC413323 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428450 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428451 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428452 | WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY413323 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1 | 100 ug |
$436.00
|
|
LY428450 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2 | 100 ug |
$436.00
|
|
LY428451 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3 | 100 ug |
$436.00
|
|
LY428452 | Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4 | 100 ug |
$436.00
|
|
TP300142 | Recombinant protein of human WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP327755 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP327773 | Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.