WDR79 (WRAP53) (NM_001143992) Human Recombinant Protein

SKU
TP327786
Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227786 protein sequence
Red=Cloning site Green=Tags(s)

MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG
DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED
EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE
YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG
LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE
SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001137464
Locus ID 55135
UniProt ID Q9BUR4
Cytogenetics 17p13.1
RefSeq Size 1896
RefSeq ORF 1644
Synonyms DKCB3; TCAB1; WDR79
Summary This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. [provided by RefSeq, Mar 2011]
Write Your Own Review
You're reviewing:WDR79 (WRAP53) (NM_001143992) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300142 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_060551) 10 ug
$3,255.00
PH327755 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137462) 10 ug
$3,255.00
PH327773 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137463) 10 ug
$3,255.00
PH327786 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137464) 10 ug
$3,255.00
LC413323 WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428450 WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428451 WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428452 WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413323 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1 100 ug
$436.00
LY428450 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2 100 ug
$436.00
LY428451 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3 100 ug
$436.00
LY428452 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4 100 ug
$436.00
TP300142 Recombinant protein of human WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1, 20 µg 20 ug
$737.00
TP327755 Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2, 20 µg 20 ug
$737.00
TP327773 Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.