ALS2CR1 (NIF3L1) (NM_001136039) Human Recombinant Protein
SKU
TP327762
Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC227762 protein sequence
Red=Cloning site Green=Tags(s) MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL RDMLDSHLENKINIILSETDRDPLQVV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001129511 |
Locus ID | 60491 |
UniProt ID | Q9GZT8 |
Cytogenetics | 2q33.1 |
RefSeq Size | 1497 |
RefSeq ORF | 1131 |
Synonyms | ALS2CR1; CALS-7; MDS015 |
Summary | May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300827 | NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_068596) | 10 ug |
$3,255.00
|
|
PH327762 | NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129511) | 10 ug |
$3,255.00
|
|
PH327825 | NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001135827) | 10 ug |
$3,255.00
|
|
LC411906 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427786 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428055 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428056 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411906 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2 | 100 ug |
$436.00
|
|
LY427786 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1 | 100 ug |
$436.00
|
|
LY428055 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 3 | 100 ug |
$436.00
|
|
LY428056 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 4 | 100 ug |
$436.00
|
|
TP300827 | Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP327825 | Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.