ALS2CR1 (NIF3L1) (NM_021824) Human Mass Spec Standard

SKU
PH300827
NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_068596)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200827]
Predicted MW 42 kDa
Protein Sequence
Protein Sequence
>RC200827 protein sequence
Red=Cloning site Green=Tags(s)

MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT
NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW
LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN
LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL
ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL
RDMLDSHLENKINIILSETDRDPLQVV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068596
RefSeq Size 1649
RefSeq ORF 1131
Synonyms ALS2CR1; CALS-7; MDS015
Locus ID 60491
UniProt ID Q9GZT8
Cytogenetics 2q33.1
Summary May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ALS2CR1 (NIF3L1) (NM_021824) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327762 NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129511) 10 ug
$3,255.00
PH327825 NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001135827) 10 ug
$3,255.00
LC411906 NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427786 NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428055 NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428056 NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411906 Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2 100 ug
$436.00
LY427786 Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1 100 ug
$436.00
LY428055 Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 3 100 ug
$436.00
LY428056 Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 4 100 ug
$436.00
TP300827 Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327762 Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327825 Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.