RASGRP3 (NM_001139488) Human Recombinant Protein

SKU
TP327703
Recombinant protein of human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227703 protein sequence
Red=Cloning site Green=Tags(s)

MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF
RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK
KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL
SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS
NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL
EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG
PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL
PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS
HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 78.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001132960
Locus ID 25780
UniProt ID Q8IV61
Cytogenetics 2p22.3
RefSeq Size 4798
RefSeq ORF 2070
Synonyms GRP3
Summary The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017]
Protein Pathways B cell receptor signaling pathway, MAPK signaling pathway
Write Your Own Review
You're reviewing:RASGRP3 (NM_001139488) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH327703 RASGRP3 MS Standard C13 and N15-labeled recombinant protein (NP_001132960) 10 ug
$3,255.00
LC403524 RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427967 RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403524 Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2 100 ug
$436.00
LY427967 Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 1 100 ug
$665.00
TP761131 Purified recombinant protein of Human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.