RASGRP3 (NM_001139488) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC227703] |
Predicted MW | 78.3 kDa |
Protein Sequence |
Protein Sequence
>RC227703 protein sequence
Red=Cloning site Green=Tags(s) MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001132960 |
RefSeq Size | 4798 |
RefSeq ORF | 2070 |
Synonyms | GRP3 |
Locus ID | 25780 |
UniProt ID | Q8IV61 |
Cytogenetics | 2p22.3 |
Summary | The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017] |
Protein Pathways | B cell receptor signaling pathway, MAPK signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403524 | RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427967 | RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY403524 | Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2 | 100 ug |
$436.00
|
|
LY427967 | Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 1 | 100 ug |
$665.00
|
|
TP327703 | Recombinant protein of human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP761131 | Purified recombinant protein of Human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.