RASGRP3 (NM_001139488) Human Mass Spec Standard

SKU
PH327703
RASGRP3 MS Standard C13 and N15-labeled recombinant protein (NP_001132960)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227703]
Predicted MW 78.3 kDa
Protein Sequence
Protein Sequence
>RC227703 protein sequence
Red=Cloning site Green=Tags(s)

MGSSGLGKAATLDELLCTCIEMFDDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCMYRNATGESCNEF
RLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSK
KGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVL
SKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSS
NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHL
EPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTVINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCKMG
PGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFARAPSLSSGHGSL
PGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGS
HTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001132960
RefSeq Size 4798
RefSeq ORF 2070
Synonyms GRP3
Locus ID 25780
UniProt ID Q8IV61
Cytogenetics 2p22.3
Summary The protein encoded by this gene is a guanine nucleotide exchange factor that activates the oncogenes HRAS and RAP1A. Defects in this gene have been associated with systemic lupus erythematosus and several cancers. [provided by RefSeq, Mar 2017]
Protein Pathways B cell receptor signaling pathway, MAPK signaling pathway
Write Your Own Review
You're reviewing:RASGRP3 (NM_001139488) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403524 RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427967 RASGRP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403524 Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2 100 ug
$436.00
LY427967 Transient overexpression lysate of RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 1 100 ug
$665.00
TP327703 Recombinant protein of human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, 20 µg 20 ug
$737.00
TP761131 Purified recombinant protein of Human RAS guanyl releasing protein 3 (calcium and DAG-regulated) (RASGRP3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.