NEK6 (NM_001145001) Human Recombinant Protein

SKU
TP327083
Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227083 representing NM_001145001
Red=Cloning site Green=Tags(s)

MPRREVCWEAAHFRQEEQSLPRPRVRALVRLACRMAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTL
SFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNII
KYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPA
NVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSP
FYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001138473
Locus ID 10783
UniProt ID Q9HC98
Cytogenetics 9q33.3
RefSeq ORF 1041
Synonyms SID6-1512
Summary The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:NEK6 (NM_001145001) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303609 NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_055212) 10 ug
$3,255.00
PH327083 NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138473) 10 ug
$3,255.00
LC402327 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428635 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431292 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431305 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431846 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431847 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402327 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2 100 ug
$436.00
LY428635 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1 100 ug
$436.00
LY431292 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 3 100 ug
$436.00
LY431305 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 7 100 ug
$436.00
LY431846 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5 100 ug
$436.00
LY431847 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 6 100 ug
$436.00
TP303609 Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2, 20 µg 20 ug
$737.00
TP328818 Purified recombinant protein of Homo sapiens NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.