NEK6 (NM_001145001) Human Mass Spec Standard

SKU
PH327083
NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138473)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227083]
Predicted MW 39.7 kDa
Protein Sequence
Protein Sequence
>RC227083 representing NM_001145001
Red=Cloning site Green=Tags(s)

MPRREVCWEAAHFRQEEQSLPRPRVRALVRLACRMAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTL
SFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNII
KYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPA
NVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSP
FYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138473
RefSeq ORF 1041
Synonyms SID6-1512
Locus ID 10783
UniProt ID Q9HC98
Cytogenetics 9q33.3
Summary The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:NEK6 (NM_001145001) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303609 NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_055212) 10 ug
$3,255.00
LC402327 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428635 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431292 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431305 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431846 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431847 NEK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402327 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2 100 ug
$436.00
LY428635 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1 100 ug
$436.00
LY431292 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 3 100 ug
$436.00
LY431305 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 7 100 ug
$436.00
LY431846 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5 100 ug
$436.00
LY431847 Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 6 100 ug
$436.00
TP303609 Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2, 20 µg 20 ug
$737.00
TP327083 Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1, 20 µg 20 ug
$737.00
TP328818 Purified recombinant protein of Homo sapiens NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.