DDX4 (NM_001136034) Human Recombinant Protein

SKU
TP326957
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226957 protein sequence
Red=Cloning site Green=Tags(s)

MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDA
GECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSE
ASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGG
YKGLNEEVITGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSG
HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHM
MHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC
ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQR
LAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFL
CQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGR
TGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKG
KSTLNTAGFSSSQAPNPVDDESWD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 79.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001129506
Locus ID 54514
UniProt ID Q9NQI0
Cytogenetics 5q11.2
RefSeq Size 2880
RefSeq ORF 2172
Synonyms DEAD (Asp-Glu-Ala-Asp) box polypeptide 4; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4; MGC111074; OTTHUMP00000122546; VASA
Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:DDX4 (NM_001136034) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310628 DDX4 MS Standard C13 and N15-labeled recombinant protein (NP_077726) 10 ug
$3,255.00
PH326957 DDX4 MS Standard C13 and N15-labeled recombinant protein (NP_001129506) 10 ug
$3,255.00
LC411272 DDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427781 DDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433297 DDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411272 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 1 100 ug
$436.00
LY427781 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 3 100 ug
$665.00
LY433297 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 4 100 ug
$436.00
TP310628 Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.