DDX4 (NM_024415) Human Mass Spec Standard

SKU
PH310628
DDX4 MS Standard C13 and N15-labeled recombinant protein (NP_077726)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210628]
Predicted MW 79.3 kDa
Protein Sequence
Protein Sequence
>RC210628 protein sequence
Red=Cloning site Green=Tags(s)

MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDA
GECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSE
ASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGG
YKGLNEEVITGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSG
HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHM
MHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC
ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQR
LAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFL
CQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGR
TGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKG
KSTLNTAGFSSSQAPNPVDDESWD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077726
RefSeq Size 2880
RefSeq ORF 2172
Synonyms VASA
Locus ID 54514
UniProt ID Q9NQI0
Cytogenetics 5q11.2
Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:DDX4 (NM_024415) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH326957 DDX4 MS Standard C13 and N15-labeled recombinant protein (NP_001129506) 10 ug
$3,255.00
LC411272 DDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427781 DDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433297 DDX4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411272 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 1 100 ug
$436.00
LY427781 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 3 100 ug
$665.00
LY433297 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 4 100 ug
$436.00
TP310628 Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 1, 20 µg 20 ug
$737.00
TP326957 Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 (DDX4), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.