HOMER3 (NM_001145724) Human Recombinant Protein
CAT#: TP326721
Purified recombinant protein of Homo sapiens homer homolog 3 (Drosophila) (HOMER3), transcript variant 4, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226721 representing NM_001145724
Red=Cloning site Green=Tags(s) MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF TKTSQKFGQWADSRANTVYGLGFASEQHLTQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLS EGSVGEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTG EKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDLETRNAELEHQLRAMER SLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139196 |
Locus ID | 9454 |
UniProt ID | Q9NSC5 |
Cytogenetics | 19p13.11 |
Refseq ORF | 975 |
Synonyms | HOMER-3; VESL3 |
Summary | This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein interactions, and a carboxy-terminal coiled-coil domain and two leucine zipper motifs that are involved in self-oligomerization. The encoded protein binds numerous other proteins including group I metabotropic glutamate receptors, inositol 1,4,5-trisphosphate receptors and amyloid precursor proteins and has been implicated in diverse biological functions such as neuronal signaling, T-cell activation and trafficking of amyloid beta peptides. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417705 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428985 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428986 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428987 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417705 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 2 |
USD 436.00 |
|
LY428985 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 3 |
USD 436.00 |
|
LY428986 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 1 |
USD 436.00 |
|
LY428987 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 4 |
USD 436.00 |
|
PH304168 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829) |
USD 3,255.00 |
|
PH326668 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194) |
USD 3,255.00 |
|
PH326721 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196) |
USD 3,255.00 |
|
TP304168 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 2, 20 µg |
USD 867.00 |
|
TP326668 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review