HOMER3 (NM_001145724) Human Mass Spec Standard

SKU
PH326721
HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226721]
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC226721 representing NM_001145724
Red=Cloning site Green=Tags(s)

MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF
TKTSQKFGQWADSRANTVYGLGFASEQHLTQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLS
EGSVGEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTG
EKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDLETRNAELEHQLRAMER
SLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139196
RefSeq ORF 975
Synonyms HOMER-3; VESL3
Locus ID 9454
UniProt ID Q9NSC5
Cytogenetics 19p13.11
Summary This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein interactions, and a carboxy-terminal coiled-coil domain and two leucine zipper motifs that are involved in self-oligomerization. The encoded protein binds numerous other proteins including group I metabotropic glutamate receptors, inositol 1,4,5-trisphosphate receptors and amyloid precursor proteins and has been implicated in diverse biological functions such as neuronal signaling, T-cell activation and trafficking of amyloid beta peptides. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HOMER3 (NM_001145724) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304168 HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829) 10 ug
$3,255.00
PH326668 HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194) 10 ug
$3,255.00
LC417705 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428985 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428986 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428987 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417705 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 2 100 ug
$436.00
LY428985 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 3 100 ug
$436.00
LY428986 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 1 100 ug
$436.00
LY428987 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 4 100 ug
$436.00
TP304168 Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 2, 20 µg 20 ug
$737.00
TP326668 Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 1, 20 µg 20 ug
$737.00
TP326721 Purified recombinant protein of Homo sapiens homer homolog 3 (Drosophila) (HOMER3), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.