HOMER3 (NM_001145724) Human Recombinant Protein

SKU
TP326721
Purified recombinant protein of Homo sapiens homer homolog 3 (Drosophila) (HOMER3), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226721 representing NM_001145724
Red=Cloning site Green=Tags(s)

MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF
TKTSQKFGQWADSRANTVYGLGFASEQHLTQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLS
EGSVGEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTG
EKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDLETRNAELEHQLRAMER
SLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAAP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001139196
Locus ID 9454
UniProt ID Q9NSC5
Cytogenetics 19p13.11
RefSeq ORF 975
Synonyms HOMER-3; VESL3
Summary This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein interactions, and a carboxy-terminal coiled-coil domain and two leucine zipper motifs that are involved in self-oligomerization. The encoded protein binds numerous other proteins including group I metabotropic glutamate receptors, inositol 1,4,5-trisphosphate receptors and amyloid precursor proteins and has been implicated in diverse biological functions such as neuronal signaling, T-cell activation and trafficking of amyloid beta peptides. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HOMER3 (NM_001145724) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304168 HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829) 10 ug
$3,255.00
PH326668 HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194) 10 ug
$3,255.00
PH326721 HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196) 10 ug
$3,255.00
LC417705 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428985 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428986 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428987 HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417705 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 2 100 ug
$436.00
LY428985 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 3 100 ug
$436.00
LY428986 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 1 100 ug
$436.00
LY428987 Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 4 100 ug
$436.00
TP304168 Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 2, 20 µg 20 ug
$737.00
TP326668 Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.