KLC2 (NM_001134776) Human Recombinant Protein

SKU
TP326035
Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226035 protein sequence
Red=Cloning site Green=Tags(s)

MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL
GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM
SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS
QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA
VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA
LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE
SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK
VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML
VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 68.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001128248
Locus ID 64837
UniProt ID Q9H0B6
Cytogenetics 11q13.2
RefSeq Size 2972
RefSeq ORF 1866
Summary The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:KLC2 (NM_001134776) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314206 KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_073733) 10 ug
$3,255.00
PH326034 KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128247) 10 ug
$3,255.00
PH326035 KLC2 MS Standard C13 and N15-labeled recombinant protein (NP_001128248) 10 ug
$3,255.00
LC402950 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427490 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427491 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427492 KLC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402950 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 1 100 ug
$436.00
LY427490 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 2 100 ug
$436.00
LY427491 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 3 100 ug
$436.00
LY427492 Transient overexpression lysate of kinesin light chain 2 (KLC2), transcript variant 4 100 ug
$436.00
TP314206 Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 1, 20 µg 20 ug
$737.00
TP326034 Recombinant protein of human kinesin light chain 2 (KLC2), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.